Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FbpC Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex C; Fibronectin-binding protein C.

Accession Number

WP_003400908.1

Reactivity

Mycobacterium tuberculosis

Target

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs) . They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha, alpha-trehalose dimycolate (TDM, cord factor) . They catalyze the transfer of a mycoloyl residue from one molecule of alpha, alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM (By similarity) .

Type

Protein

Source

E.coli

Sequence

AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FBPC

Protein Name

Diacylglycerol acyltransferase/mycolyltransferase Ag85C

Gene Name URL

FBPC

Nucleotide Accession Number

NZ_KK341227.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOCS2 siRNA (Rat)
CRR4372-01 15 nmol

MOCS2 siRNA (Rat)

Sign In for Pricing
View Details
MOCS2 siRNA (Rat)
CRR4372-02 30 nmol

MOCS2 siRNA (Rat)

Sign In for Pricing
View Details
Mouse Pla2g4f activation kit by CRISPRa
GA216116 1 Kit

Mouse Pla2g4f activation kit by CRISPRa

Sign In for Pricing
View Details
ITGA2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1103208 1.0 µg DNA

ITGA2B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human CD53 Protein, N-GST & C-His
orb3153019-01 50 µg

Recombinant Human CD53 Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Human CD53 Protein, N-GST & C-His
orb3153019-02 100 µg

Recombinant Human CD53 Protein, N-GST & C-His

Sign In for Pricing
View Details