Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rd Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Rd

Reactivity

Clostridium pasteurianum

Target

Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule.

Type

Protein

Source

E.coli

Sequence

MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22 kda

Protein Length

Recombinant

Host or Source

Clostridium pasteurianum

Protein Name

Rubredoxin

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IDH1 (C-8His)
CM21-01 10 µg

Recombinant Human IDH1 (C-8His)

Sign In for Pricing
View Details
Recombinant Human IDH1 (C-8His)
CM21-02 50 µg

Recombinant Human IDH1 (C-8His)

Sign In for Pricing
View Details
Recombinant Human IDH1 (C-8His)
CM21-03 500 µg

Recombinant Human IDH1 (C-8His)

Sign In for Pricing
View Details
Recombinant Human IDH1 (C-8His)
CM21-04 1 mg

Recombinant Human IDH1 (C-8His)

Sign In for Pricing
View Details
Gbp2b Mouse shRNA Plasmid (Locus ID 14468)
TR511531 1 Kit

Gbp2b Mouse shRNA Plasmid (Locus ID 14468)

Sign In for Pricing
View Details
Human LCOR shRNA Plasmid
abx963486-01 150 µg

Human LCOR shRNA Plasmid

Sign In for Pricing
View Details