Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH-1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cellobiose-quinone oxidoreductase.

Reactivity

Phanerochaete chrysosporium

Target

Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.

Type

Protein

Source

E.coli

Sequence

QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDH-1

Host or Source

Phanerochaete chrysosporium

Protein Name

Cellobiose dehydrogenase

Gene Name URL

CDH-1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sep15 ORF Vector (Mouse) (pORF)
ORF056938 1.0 µg DNA

Sep15 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Human CD62E/SELE Protein, N-His
orb2836324-01 20 µg

Recombinant Human CD62E/SELE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD62E/SELE Protein, N-His
orb2836324-02 50 µg

Recombinant Human CD62E/SELE Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD62E/SELE Protein, N-His
orb2836324-03 100 µg

Recombinant Human CD62E/SELE Protein, N-His

Sign In for Pricing
View Details
(TCG) 7 TaqMan 5' FAM; 25 ug
44-1030-07 25 µg

(TCG) 7 TaqMan 5' FAM; 25 ug

Sign In for Pricing
View Details
Dnajc24 3'UTR Lenti-reporter-Luc Vector
18404084 1.0 µg

Dnajc24 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details