Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bla g 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Bla g IV.

Reactivity

Blattella germanica

Target

Probable ligand-binding protein.

Type

Protein

Source

Yeast

Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.8 kDa

Protein Length

Recombinant

Host or Source

Blattella germanica

Protein Name

Allergen Bla g 4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cldnd2 shRNA (UAS) - Lentiviral mouse Cldnd2 shRNA (UAS, iRFP) (100)
GTR15188667 1 Vial

Lentiviral mouse Cldnd2 shRNA (UAS) - Lentiviral mouse Cldnd2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Rauvovertine C
TN4899 5 mg

Rauvovertine C

Sign In for Pricing
View Details
Recombinant Cat Zona pellucida sperm-binding protein 4 (ZP4)
orb2902322-01 20 µg

Recombinant Cat Zona pellucida sperm-binding protein 4 (ZP4)

Sign In for Pricing
View Details
Recombinant Cat Zona pellucida sperm-binding protein 4 (ZP4)
orb2902322-02 100 µg

Recombinant Cat Zona pellucida sperm-binding protein 4 (ZP4)

Sign In for Pricing
View Details
P16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone:1H10]
E45M16887 100 µg

P16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone:1H10]

Sign In for Pricing
View Details
SHB Rabbit mAb
MBS9148026-01 0.02 mL

SHB Rabbit mAb

Sign In for Pricing
View Details