Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bla g 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Bla g IV.

Reactivity

Blattella germanica

Target

Probable ligand-binding protein.

Type

Protein

Source

Yeast

Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.8 kDa

Protein Length

Recombinant

Host or Source

Blattella germanica

Protein Name

Allergen Bla g 4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf48 siRNA Oligos set (Human)
13920171 3x 5 nmol

C16orf48 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Chicken Procollagen III N-terminal peptide (PIIINT) ELISA Kit
NSL0413Ch 96 Tests

Chicken Procollagen III N-terminal peptide (PIIINT) ELISA Kit

Sign In for Pricing
View Details
Kcmf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
25323114 3x 1.0 µg

Kcmf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rat Tenascin-R (TN-R) ELISA Kit
NSL0116r 96 Tests

Rat Tenascin-R (TN-R) ELISA Kit

Sign In for Pricing
View Details
TP53RK (TP53 Regulating Kinase, BUD32, C20orf64, Nori-2, Nori-2p, PRPK, dJ101A2) (APC)
252911-APC 100 µL

TP53RK (TP53 Regulating Kinase, BUD32, C20orf64, Nori-2, Nori-2p, PRPK, dJ101A2) (APC)

Sign In for Pricing
View Details
Cyclin D1 Antibody
orb1712463 1 mL

Cyclin D1 Antibody

Sign In for Pricing
View Details