Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HlgB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

H-gamma-1; H-gamma-I.

Reactivity

Staphylococcus aureus

Target

Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity (By similarity) .

Type

Protein

Source

E.coli

Sequence

AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HLGB

Host or Source

Staphylococcus aureus

Protein Name

Gamma-hemolysin component B

Gene Name URL

HLGB

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA2 antibody
FNab03687 100 µg

GSTA2 antibody

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)
MBS1146621-01 0.02 mg (E-Coli)

Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)
MBS1146621-02 0.1 mg (E-Coli)

Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)
MBS1146621-03 0.02 mg (Yeast)

Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)
MBS1146621-04 0.1 mg (Yeast)

Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)
MBS1146621-05 0.02 mg (Baculovirus)

Recombinant Arcobacter butzleri Phosphoheptose isomerase (gmhA)

Sign In for Pricing
View Details