Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY6H Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Lymphocyte antigen 6 family member H

Gene Aliases

Ly-6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6.

Gene ID

4062

Accession Number

NP_001123950.1

Reactivity

Homo sapiens|Human

Target

Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons.

Type

Protein

Source

Yeast

Sequence

LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LY6H

Host or Source

Human

Protein Name

Lymphocyte antigen 6H

Gene Name URL

LY6H

Nucleotide Accession Number

NM_001130478.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perilipin-3/TIP47 Blocking Peptide - (Dry Ice)
NB110-40764PEP 0.05 mg

Perilipin-3/TIP47 Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
Rat Carnitine Palmitoyltransferase 1A, Liver (CPT1A) ELISA Kit
BSKR65679-01 48 Tests

Rat Carnitine Palmitoyltransferase 1A, Liver (CPT1A) ELISA Kit

Sign In for Pricing
View Details
Rat Carnitine Palmitoyltransferase 1A, Liver (CPT1A) ELISA Kit
BSKR65679-02 96 Tests

Rat Carnitine Palmitoyltransferase 1A, Liver (CPT1A) ELISA Kit

Sign In for Pricing
View Details
Connexin 40, CT (CX40, Gap Junction alpha 5 Protein, CXA-5) (APC)
MBS6258174-01 0.1 mL

Connexin 40, CT (CX40, Gap Junction alpha 5 Protein, CXA-5) (APC)

Sign In for Pricing
View Details
Connexin 40, CT (CX40, Gap Junction alpha 5 Protein, CXA-5) (APC)
MBS6258174-02 5x 0.1 mL

Connexin 40, CT (CX40, Gap Junction alpha 5 Protein, CXA-5) (APC)

Sign In for Pricing
View Details
Phospho-Cyclin C (Ser275) Rabbit Polyclonal Antibody (Biotin)
orb501722 100 µL

Phospho-Cyclin C (Ser275) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details