Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scgb3a2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Secretoglobin, family 3A, member 2

Gene Aliases

LuLe; LuLeu1; pneumo secretory protein 1; Pnsp1; secretoglobin family 3A member 2; UGR; UGRP1; uteroglobin related protein 1; Uteroglobin-related protein 1; Utgrp1.

Gene ID

117158

Accession Number

NP_001276572.1

Reactivity

Mouse|Mus musculus

Target

Secreted cytokine-like protein (By similarity) . Binds to the scavenger receptor MARCO (By similarity) . Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast (By similarity) . Strongly inhibits phospholipase A2 (PLA2G1B) activity (PubMed:24213919) . Seems to have anti-inflammatory effects in respiratory epithelium (PubMed:16456148, PubMed:25242865) . Also has anti-fibrotic activity in lung (PubMed:24213919, PubMed:26559674) . May play a role in fetal lung development and maturation (PubMed:18535256) . Promotes branching morphogenesis during early stages of lung development (PubMed:18535256) . In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) (PubMed:24514953) .

Type

Protein

Source

Yeast

Sequence

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Scgb3a2

Host or Source

Mouse

Protein Name

Secretoglobin family 3A member 2

Gene Name URL

Scgb3a2

Nucleotide Accession Number

NM_001289643.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1157204-01 0.02 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1157204-02 0.1 mg (E-Coli)

Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1157204-03 0.02 mg (Yeast)

Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1157204-04 0.1 mg (Yeast)

Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1157204-05 0.02 mg (Baculovirus)

Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)
MBS1157204-06 0.02 mg (Mammalian-Cell)

Recombinant Archaeoglobus fulgidus Probable inorganic polyphosphate/ATP-NAD kinase (ppnK)

Sign In for Pricing
View Details