Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNG Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

IFN-gamma

Reactivity

Marmota monax|Woodchuck

Target

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Type

Protein

Source

Yeast

Sequence

QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IFNG

Host or Source

Marmota monax

Protein Name

Interferon gamma

Gene Name URL

IFNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AGMAT shRNA (UAS) - Lentiviral human AGMAT shRNA (UAS, iRFP) (100)
GTR15086451 1 Vial

Lentiviral human AGMAT shRNA (UAS) - Lentiviral human AGMAT shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Slc9a3 3'UTR GFP Stable Cell Line
TU169230 1.0 mL

Slc9a3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
n-Myc Peptide
AF6881-BP 1 mg

n-Myc Peptide

Sign In for Pricing
View Details
MIR3180-5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV768037 1.0 µg DNA

MIR3180-5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
γ- (6-Aminohexyl) -ATP – ATTO-532
JBS-NU-833-532 120 µL

γ- (6-Aminohexyl) -ATP – ATTO-532

Sign In for Pricing
View Details
Mouse Monoclonal alpha Tubulin Antibody (961258) [FITC]
MAB93441F 100 µL

Mouse Monoclonal alpha Tubulin Antibody (961258) [FITC]

Sign In for Pricing
View Details