What is the catalog number for IFNG Recombinant Protein?

The catalog number for IFNG Recombinant Protein is OPCA03462-20UG.

What sizes are available for IFNG Recombinant Protein?

IFNG Recombinant Protein is available in the following size(s): 20 µg.

Is IFNG Recombinant Protein in stock?

IFNG Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

IFNG Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

IFN-gamma

Reactivity

Marmota monax|Woodchuck

Target

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Type

Protein

Source

Yeast

Sequence

QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.