RpII215 Recombinant Protein
Product Specifications
CAS Number
9000-83-3
Gene Name
RNA polymerase II 215kD subunit
Gene Aliases
5;8WG16; alphaPol IIo[ser2]; CG1554; CG1554-PA; CTD; DmCTD; Dmel\CG1554; Dmel_CG1554; DNA-directed RNA polymerase III largest subunit; dRPB1; H5; II; IIo; l (1) 10Ca; l (1) DC912; l (1) DF912; l (1) G0040; l (1) L5; L5; POL; Pol II; Pol II CTD; Pol II large subunit; Pol II large subunit CTD; Pol II Ser5P; Pol II[ser2]; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[Ser2]; Pol IIo[ser5]; PolII; Pol-II; PolIIa; Pol-IIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; polymerase II CTD; RNA Pol II; RNA Pol II CTD; RNA pol IIo; RNA PolI 215; RNA PolII; RNA polymerase II; RNA polymerase II 215kD subunit; RNA polymerase II large subunit; RNA polymerase II largest subunit; RNA polymerase IIo; RNA polymeraseII-215 kd subunit; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII0; RNApol; RNA-Pol; RNApol2; RNApolII; RNA-PolII; RNA-polymerase II; Rpb1; RpII; rpII1; RPII215; RpII215-PA; Rpll215; Ser5-P Pol II; Ubl; Ultrabithorax-like.
Gene ID
32100
Accession Number
NP_511124.1
Reactivity
Drosophila melanogaster
Target
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing (By similarity) .
Type
Protein
Source
Yeast
Sequence
YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPT
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
33.6 kDa
Protein Length
Recombinant
NCBI Gene Symbol
RpII215
Host or Source
Drosophila melanogaster
Protein Name
DNA-directed RNA polymerase II subunit RPB1
Gene Name URL
RpII215
Nucleotide Accession Number
NM_078569.3
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog