What is the catalog number for TREM2 Recombinant Protein?

The catalog number for TREM2 Recombinant Protein is OPCA03460-100UG.

What sizes are available for TREM2 Recombinant Protein?

TREM2 Recombinant Protein is available in the following size(s): 100 µg.

Is TREM2 Recombinant Protein in stock?

TREM2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

TREM2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Triggering receptor expressed on myeloid cells 2

Gene Aliases

PLOSL2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on monocytes 2; triggering receptor expressed on myeloid cells 2; triggering receptor expressed on myeloid cells 2a.

Gene ID

54209

Accession Number

NP_001258750.1

Reactivity

Homo sapiens|Human

Target

Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.

Type

Protein

Source

Yeast

Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.