Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPSB2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tryptase alpha/beta 1|tryptase beta 2

Gene Aliases

Epididymis secretory sperm binding protein; mast cell alpha II tryptase; mast cell beta I tryptase; mast cell tryptase beta II; mast cell tryptase beta III; testicular tissue protein Li 163; TPS1; TPS2; TPSB1; TPSB2; tryptase alpha II; tryptase alpha/beta-1; tryptase alpha-1; tryptase beta I; tryptase beta-1; Tryptase beta-2; Tryptase II; tryptase-1; Tryptase-2; tryptaseB; tryptaseC; tryptase-I; tryptase-III.

Gene ID

64499|7177

Accession Number

NP_003285.2

Reactivity

Homo sapiens|Human

Target

Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity.

Type

Protein

Source

E.coli

Sequence

IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TPSAB1|TPSB2

Host or Source

Human

Protein Name

Tryptase beta-2

Gene Name URL

TPSAB1|TPSB2

Nucleotide Accession Number

NM_003294.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMP Salt Active Nuclease
orb1939673-01 100 KU

GMP Salt Active Nuclease

Sign In for Pricing
View Details
GMP Salt Active Nuclease
orb1939673-02 500 KU

GMP Salt Active Nuclease

Sign In for Pricing
View Details
GMP Salt Active Nuclease
orb1939673-03 5000 ku

GMP Salt Active Nuclease

Sign In for Pricing
View Details
Hippi shRNA Plasmid (m)
sc-145971-SH 20 µg

Hippi shRNA Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Asb15 shRNA (UAS) - Lentiviral mouse Asb15 shRNA (UAS, RFP) (100)
GTR15134028 1 Vial

Lentiviral mouse Asb15 shRNA (UAS) - Lentiviral mouse Asb15 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Ik-set siRNA/shRNA/RNAi Lentivector (Rat)
24793096 4x 500 ng

Ik-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details