Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sprr2a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Small proline-rich protein 2A1|small proline-rich protein 2A2|small proline-rich protein 2A3

Gene Aliases

S; small proline-rich protein 2A; Small proline-rich protein 2A1; small proline-rich protein 2A2; Small proline-rich protein 2A3; Sprr2a; Sprr2a1; Sprr2a3.

Gene ID

100042514|100303744|20755

Reactivity

Mouse|Mus musculus

Target

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

13.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Sprr2a1|Sprr2a2|Sprr2a3

Host or Source

Mouse

Protein Name

Small proline-rich protein 2A1

Gene Name URL

Sprr2a1|Sprr2a2|Sprr2a3

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human/Mouse/Rat UCH-L1 Affinity Purified Polyclonal Ab
AF6007-SP 25 µg

Human/Mouse/Rat UCH-L1 Affinity Purified Polyclonal Ab

Ask
View Details
Spetex-2D CRISPR All-in-one AAV vector set (with saCas9)(Rat)
45278156 3x 1.0 µg DNA

Spetex-2D CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Ask
View Details
CD14 (CD14 Antigen, Lipopolysaccharide Receptor, LPSR, Monocyte Differentiation Antigen 14, Myeloid Cell Specific Leucine Rich Glycoprotein) (FITC)
C2265-32H 100 µg

CD14 (CD14 Antigen, Lipopolysaccharide Receptor, LPSR, Monocyte Differentiation Antigen 14, Myeloid Cell Specific Leucine Rich Glycoprotein) (FITC)

Ask
View Details
CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 550)
MBS6254642-01 0.1 mL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 550)

Ask
View Details
CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 550)
MBS6254642-02 5x 0.1 mL

CD45 (CD45 Antigen, B220, GP180, Leukocyte Common Antigen, LCA, L-CA, LY5, LY-5, Protein Tyrosine Phosphatase Receptor Type C, Protein Tyrosine Phosphatase Receptor Type C Polypeptide, PTPRC, T200, T200 Glycoprotein) (MaxLight 550)

Ask
View Details
LOC162137 Human shRNA Lentiviral Particle (Locus ID 162137)
TL319144V 500 µL Each

LOC162137 Human shRNA Lentiviral Particle (Locus ID 162137)

Ask
View Details