Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sprr2a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Small proline-rich protein 2A1|small proline-rich protein 2A2|small proline-rich protein 2A3

Gene Aliases

S; small proline-rich protein 2A; Small proline-rich protein 2A1; small proline-rich protein 2A2; Small proline-rich protein 2A3; Sprr2a; Sprr2a1; Sprr2a3.

Gene ID

100042514|100303744|20755

Reactivity

Mouse|Mus musculus

Target

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

13.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Sprr2a1|Sprr2a2|Sprr2a3

Host or Source

Mouse

Protein Name

Small proline-rich protein 2A1

Gene Name URL

Sprr2a1|Sprr2a2|Sprr2a3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIPES Buffer 1M, pH 8.0
41620043-1 100 mL

PIPES Buffer 1M, pH 8.0

Sign In for Pricing
View Details
NLRX1 (NOD26, NOD5, NOD9) discontinued
512106 100 µg

NLRX1 (NOD26, NOD5, NOD9) discontinued

Sign In for Pricing
View Details
DLC-1 shRNA Plasmid (h)
sc-43725-SH 20 µg

DLC-1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Loxl4 (NM_053083) Mouse Tagged ORF Clone
MG218009 10 µg

Loxl4 (NM_053083) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Canine Kallikrein 12 (KLK12) ELISA Kit
EIA07879Ca 1 Kit

Canine Kallikrein 12 (KLK12) ELISA Kit

Sign In for Pricing
View Details
Recombinant Aromatoleum aromaticum Aspartate--tRNA ligase (aspS), partial
MBS1365589 Inquire

Recombinant Aromatoleum aromaticum Aspartate--tRNA ligase (aspS), partial

Sign In for Pricing
View Details