What is the catalog number for Sprr2a Recombinant Protein?

The catalog number for Sprr2a Recombinant Protein is OPCA03450-100UG.

What sizes are available for Sprr2a Recombinant Protein?

Sprr2a Recombinant Protein is available in the following size(s): 100 µg.

Is Sprr2a Recombinant Protein in stock?

Sprr2a Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Sprr2a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Small proline-rich protein 2A1|small proline-rich protein 2A2|small proline-rich protein 2A3

Gene Aliases

S; small proline-rich protein 2A; Small proline-rich protein 2A1; small proline-rich protein 2A2; Small proline-rich protein 2A3; Sprr2a; Sprr2a1; Sprr2a3.

Gene ID

100042514|100303744|20755

Reactivity

Mouse|Mus musculus

Target

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol