Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YihF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DUF945 domain-containing protein YihF

Gene Aliases

B3861; DUF945 domain-containing protein YihF; ECK3853.

Gene ID

948352

Reactivity

Escherichia coli

Type

Protein

Source

E.coli

Sequence

GTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQLGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLPLLQKSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFNGQEMSEEEFMSRAGRFVH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

66.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

YihF

Host or Source

Escherichia coli

Protein Name

Uncharacterized protein YihF

Gene Name URL

YihF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RNASE11 Protein - (Dry Ice)
H00122651-P01-25ug 25 µg

Recombinant Human RNASE11 Protein - (Dry Ice)

Sign In for Pricing
View Details
NID2 Polyclonal Antibody
UB-GEN-5718 100 µL

NID2 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit
MBS160021-01 48 Well

Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit
MBS160021-02 96 Well

Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit
MBS160021-03 5x 96 Well

Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit

Sign In for Pricing
View Details
Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit
MBS160021-04 10x 96 Well

Rat Phosphorylated acetyl-CoA catboxylase, pACCase ELISA Kit

Sign In for Pricing
View Details