Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YihF Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DUF945 domain-containing protein YihF

Gene Aliases

B3861; DUF945 domain-containing protein YihF; ECK3853.

Gene ID

948352

Reactivity

Escherichia coli

Type

Protein

Source

E.coli

Sequence

GTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGNQQLGSGEWSLIAESIDPSAVRQFIIQYNIAMQKQLAAHPELANDEVALQEVNAALFKEYLPLLQKSEPTIKQPVRWKNALGELNANLDISIADPAKSSSSTNKDIKSLNFDVKLPLNVVTETAKQLNLSEGMDAEKAQKQADKQISGMMTLGQMFQLITIDNNTASLQLRYTPGKVVFNGQEMSEEEFMSRAGRFVH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

66.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

YihF

Host or Source

Escherichia coli

Protein Name

Uncharacterized protein YihF

Gene Name URL

YihF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit
MBS9392865-01 48 Well

Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit

Sign In for Pricing
View Details
Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit
MBS9392865-02 96 Well

Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit

Sign In for Pricing
View Details
Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit
MBS9392865-03 5x 96 Well

Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit

Sign In for Pricing
View Details
Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit
MBS9392865-04 10x 96 Well

Hamster 80kDa MCM3-Associated Protein (MCM3AP) ELISA Kit

Sign In for Pricing
View Details
OAS2 Mouse Monoclonal Antibody [Clone ID: OTI5C10]
CF802806 100 µg

OAS2 Mouse Monoclonal Antibody [Clone ID: OTI5C10]

Sign In for Pricing
View Details
Recombinant Murine Granulocyte Colony-stimulating Factor
orb1906188-01 10 µg

Recombinant Murine Granulocyte Colony-stimulating Factor

Sign In for Pricing
View Details