Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLPII Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Phl p II.

Reactivity

Phleum pratense

Type

Protein

Source

E.coli

Sequence

VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHLPII

Host or Source

Phleum pratens

Protein Name

Pollen allergen Phl p 2

Gene Name URL

PHLPII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35A2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV669611 1.0 µg DNA

SLC35A2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ATP6V0D2 Rabbit Polyclonal Antibody
orb325997 100 µL

ATP6V0D2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Fluoro-4- (4-t-butylphenyl) benzoic acid
417757-01 100 mg

2-Fluoro-4- (4-t-butylphenyl) benzoic acid

Sign In for Pricing
View Details
2-Fluoro-4- (4-t-butylphenyl) benzoic acid
417757-02 250 mg

2-Fluoro-4- (4-t-butylphenyl) benzoic acid

Sign In for Pricing
View Details
IL11RA Peptide - N-terminal region (AAP46466)
AAP46466-100UG 100 µg

IL11RA Peptide - N-terminal region (AAP46466)

Sign In for Pricing
View Details
Mark4 3'UTR Luciferase Stable Cell Line
TU112924 1.0 mL

Mark4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details