Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLPI Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Phl p I.

Reactivity

Phleum pratense

Type

Protein

Source

E.coli

Sequence

IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHLPI

Host or Source

Phleum pratense

Protein Name

Pollen allergen Phl p 1

Gene Name URL

PHLPI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blue Purose 6 Fast Flow
MBS8579624-01 10 mL

Blue Purose 6 Fast Flow

Sign In for Pricing
View Details
Blue Purose 6 Fast Flow
MBS8579624-02 25 mL

Blue Purose 6 Fast Flow

Sign In for Pricing
View Details
Blue Purose 6 Fast Flow
MBS8579624-03 100 mL

Blue Purose 6 Fast Flow

Sign In for Pricing
View Details
Blue Purose 6 Fast Flow
MBS8579624-04 500 mL

Blue Purose 6 Fast Flow

Sign In for Pricing
View Details
Blue Purose 6 Fast Flow
MBS8579624-05 1 L

Blue Purose 6 Fast Flow

Sign In for Pricing
View Details
INPP5F (OCRL) (NM_001587) Human Untagged Clone
SC119145 10 µg

INPP5F (OCRL) (NM_001587) Human Untagged Clone

Sign In for Pricing
View Details