Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLPI Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Phl p I.

Reactivity

Phleum pratense

Type

Protein

Source

E.coli

Sequence

IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKLTGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHLPI

Host or Source

Phleum pratense

Protein Name

Pollen allergen Phl p 1

Gene Name URL

PHLPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Neurotrophin 3 "Super-X" Pre-Coated ELISA Kit
RHF470CKX2 2x 96 Tests

Human Neurotrophin 3 "Super-X" Pre-Coated ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella flexneri Protein mxiA (mxiA), partial
MBS7062278 Inquire

Recombinant Shigella flexneri Protein mxiA (mxiA), partial

Sign In for Pricing
View Details
Mucin 22 Lentiviral Activation Particles (h2)
sc-418862-LAC-2 200 µL

Mucin 22 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
3-Iodo-5-methylbenzoic acid
CCA10790-01 0.5 g

3-Iodo-5-methylbenzoic acid

Sign In for Pricing
View Details
3-Iodo-5-methylbenzoic acid
CCA10790-02 5 g

3-Iodo-5-methylbenzoic acid

Sign In for Pricing
View Details
SLC5A9 Rabbit pAb, Pacific Blue conjugated
orb2823010 100 µL

SLC5A9 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details