Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRO1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pollen allergen Cyn d 12.

Reactivity

Cynodon dactylon

Target

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity) .

Type

Protein

Source

E.coli

Sequence

SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PRO1

Host or Source

Cynodon dactylon

Protein Name

Profilin

Gene Name URL

PRO1

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Alpha-2-Macroglobulin (a2M)
TRV-0017396-01 24 Tests

ELISA Kit for Alpha-2-Macroglobulin (a2M)

Sign In for Pricing
View Details
ELISA Kit for Alpha-2-Macroglobulin (a2M)
TRV-0017396-02 48 Tests

ELISA Kit for Alpha-2-Macroglobulin (a2M)

Sign In for Pricing
View Details
ELISA Kit for Alpha-2-Macroglobulin (a2M)
TRV-0017396-03 96 Tests

ELISA Kit for Alpha-2-Macroglobulin (a2M)

Sign In for Pricing
View Details
ELISA Kit for Alpha-2-Macroglobulin (a2M)
TRV-0017396-04 5x 96 Tests

ELISA Kit for Alpha-2-Macroglobulin (a2M)

Sign In for Pricing
View Details
ELISA Kit for Alpha-2-Macroglobulin (a2M)
TRV-0017396-05 10x 96 Tests

ELISA Kit for Alpha-2-Macroglobulin (a2M)

Sign In for Pricing
View Details
Recombinant Wound tumor virus Non-structural protein PNS7 (S6), partial
MBS1200984 Inquire

Recombinant Wound tumor virus Non-structural protein PNS7 (S6), partial

Sign In for Pricing
View Details