Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRO1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pollen allergen Cyn d 12.

Reactivity

Cynodon dactylon

Target

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity) .

Type

Protein

Source

E.coli

Sequence

SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PRO1

Host or Source

Cynodon dactylon

Protein Name

Profilin

Gene Name URL

PRO1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RppH Antibody
orb827939 2 mg

RppH Antibody

Sign In for Pricing
View Details
Human Periostin/ OSF-2 ELISA Kit
NR-E11133-01 96 Tests

Human Periostin/ OSF-2 ELISA Kit

Sign In for Pricing
View Details
Human Periostin/ OSF-2 ELISA Kit
NR-E11133-02 96 Tests

Human Periostin/ OSF-2 ELISA Kit

Sign In for Pricing
View Details
CD40 (Biotin)
C2392-03A-Biotin 100 µL

CD40 (Biotin)

Sign In for Pricing
View Details
Tfam Rabbit Polyclonal Antibody (Biotin)
orb2099674 100 µL

Tfam Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Myelin PLP (Myelin proteolipid Protein, PLP, Lipophilin, PLP1, PLP) (MaxLight 490) discontinued
302580-ML490 100 µL

Myelin PLP (Myelin proteolipid Protein, PLP, Lipophilin, PLP1, PLP) (MaxLight 490) discontinued

Sign In for Pricing
View Details