Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRO1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pollen allergen Cyn d 12.

Reactivity

Cynodon dactylon

Target

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity) .

Type

Protein

Source

E.coli

Sequence

SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PRO1

Host or Source

Cynodon dactylon

Protein Name

Profilin

Gene Name URL

PRO1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLT1B Conjugated Antibody
orb1614981 100 µL

GOLT1B Conjugated Antibody

Sign In for Pricing
View Details
Olfr410 shRNA (m) Lentiviral Particles
sc-150817-V 200 µL

Olfr410 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
P-ATP-citrate synthase (A-12) : m-IgG3 BP-HRP Bundle
sc-550581 1 Kit

P-ATP-citrate synthase (A-12) : m-IgG3 BP-HRP Bundle

Sign In for Pricing
View Details
Lentiviral mouse Emp3 shRNA (UAS) - Lentiviral mouse Emp3 shRNA (UAS) (100)
GTR15283458 1 Vial

Lentiviral mouse Emp3 shRNA (UAS) - Lentiviral mouse Emp3 shRNA (UAS) (100)

Sign In for Pricing
View Details
GENLISA™ Dickkopf Related Protein 3 (DKK3) ELISA
KLR3755 1x 96 Well

GENLISA™ Dickkopf Related Protein 3 (DKK3) ELISA

Sign In for Pricing
View Details
Mouse IL-27 ELISA Kit
EK227-01 48 Tests

Mouse IL-27 ELISA Kit

Sign In for Pricing
View Details