Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRO1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Pollen allergen Cyn d 12.

Reactivity

Cynodon dactylon

Target

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG (By similarity) .

Type

Protein

Source

E.coli

Sequence

SWQAYVDDHLMCEIEGHHLTSAAIIGHDGTVWAQSAAFPAFKPEEMANIMKDFDEPGFLAPTGLFLGPTKYMVIQGEPGAVIRGKKGSGGVTVKKTGQALVIGIYDEPMTPGQCNMVIEKLGDYLIEQGM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PRO1

Host or Source

Cynodon dactylon

Protein Name

Profilin

Gene Name URL

PRO1

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 550)
MBS6357754-01 0.1 mL

TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 550)

Sign In for Pricing
View Details
TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 550)
MBS6357754-02 5x 0.1 mL

TPSD1, CT (TPSD1, Tryptase delta, Delta-tryptase, HmMCP-3-like tryptase III, Mast cell mMCP-7-like, Tryptase-3) (MaxLight 550)

Sign In for Pricing
View Details
MYLK antibody
70R-18715 50 ul

MYLK antibody

Sign In for Pricing
View Details
Rat Na-K-Cl Cotransporter 1 (NKCC1) ELISA Kit
orb1817302-01 48 Tests

Rat Na-K-Cl Cotransporter 1 (NKCC1) ELISA Kit

Sign In for Pricing
View Details
Rat Na-K-Cl Cotransporter 1 (NKCC1) ELISA Kit
orb1817302-02 96 Tests

Rat Na-K-Cl Cotransporter 1 (NKCC1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Putative ATP:guanido phosphotransferase CPE2442 (CPE2442)
MBS1294060-01 0.02 mg (E-Coli)

Recombinant Clostridium perfringens Putative ATP:guanido phosphotransferase CPE2442 (CPE2442)

Sign In for Pricing
View Details