Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BETVIA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Bet v I-A.

Reactivity

Betula pendula

Target

May be a general steroid carrier protein.

Type

Protein

Source

E.coli

Sequence

GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BETVIA

Host or Source

Betula pendula

Protein Name

Major pollen allergen Bet v 1-A

Gene Name URL

BETVIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human FLT3 & AXL & CD40 Antibody (Sym029)
MBS1581348-01 0.1 mg

Research Grade Anti-Human FLT3 & AXL & CD40 Antibody (Sym029)

Sign In for Pricing
View Details
Research Grade Anti-Human FLT3 & AXL & CD40 Antibody (Sym029)
MBS1581348-02 1 mg

Research Grade Anti-Human FLT3 & AXL & CD40 Antibody (Sym029)

Sign In for Pricing
View Details
Research Grade Anti-Human FLT3 & AXL & CD40 Antibody (Sym029)
MBS1581348-03 5x 1 mg

Research Grade Anti-Human FLT3 & AXL & CD40 Antibody (Sym029)

Sign In for Pricing
View Details
CABLES1 Human qPCR Primer Pair (NM_138375)
HP226675 200 Reactions

CABLES1 Human qPCR Primer Pair (NM_138375)

Sign In for Pricing
View Details
mmu-miR-33-3p miRNA Antagomir
MBS8318974-01 10 nmol

mmu-miR-33-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-33-3p miRNA Antagomir
MBS8318974-02 20 nmol

mmu-miR-33-3p miRNA Antagomir

Sign In for Pricing
View Details