Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BETVII Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Bet v II; Pollen allergen Bet v 2.

Reactivity

Betula pendula

Target

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

Type

Protein

Source

E.coli

Sequence

SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BETVII

Host or Source

Betula pendula

Protein Name

Profilin-1

Gene Name URL

BETVII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 Mouse Monoclonal Antibody [Clone ID: OTI5E6]
CF813309 100 µg

YAP1 Mouse Monoclonal Antibody [Clone ID: OTI5E6]

Sign In for Pricing
View Details
G protein alpha S (GNAS) (NM_001077489) Human Recombinant Protein
TP316883 20 µg

G protein alpha S (GNAS) (NM_001077489) Human Recombinant Protein

Sign In for Pricing
View Details
CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]
AM50047PU-S 50 µL

CNBP Mouse Monoclonal Antibody [Clone ID: AT38F10]

Sign In for Pricing
View Details
Human PRDM1, N-Twin Strep, C-His, Flag Tag
HA210703-01 20 µg

Human PRDM1, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human PRDM1, N-Twin Strep, C-His, Flag Tag
HA210703-02 50 µg

Human PRDM1, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human PRDM1, N-Twin Strep, C-His, Flag Tag
HA210703-03 100 µg

Human PRDM1, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details