What is the catalog number for Lysozyme C-1 Recombinant Protein (Mallard)?

The catalog number for Lysozyme C-1 Recombinant Protein (Mallard) is OPCA03433-100UG.

What sizes are available for Lysozyme C-1 Recombinant Protein (Mallard)?

Lysozyme C-1 Recombinant Protein (Mallard) is available in the following size(s): 100 µg.

Is Lysozyme C-1 Recombinant Protein (Mallard) in stock?

Lysozyme C-1 Recombinant Protein (Mallard) is currently made to order / not held in immediate stock. Contact us for lead time.

Lysozyme C-1 Recombinant Protein (Mallard)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

1,4-beta-N-acetylmuramidase C.

Reactivity

Anas platyrhynchos|Duck

Target

Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents.

Type

Protein

Source

E.coli

Sequence

KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNTDGSTDYGILQINSRWWCDNGKTPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRCRGTDVSKWIRGCRL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.