Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbs Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Cystathionine beta-synthase

Gene Aliases

AI047524; AI303044; beta-thionase; cystathionine beta-synthase; HI; HIP4; serine sulfhydrase.

Gene ID

12411

Accession Number

NP_001258282.1

Reactivity

Mouse|Mus musculus

Target

Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (By similarity) . Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons (By similarity) .

Type

Protein

Source

E.coli

Sequence

PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

65.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Cbs

Host or Source

Mouse

Protein Name

Cystathionine beta-synthase

Gene Name URL

Cbs

Nucleotide Accession Number

NM_001271353.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1562136 Protein Vector (Rat) (pPM-C-His)
PV300493 500 ng

RGD1562136 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Tdh Rat shRNA Lentiviral Particle (Locus ID 290315)
TL704636V 500 µL Each

Tdh Rat shRNA Lentiviral Particle (Locus ID 290315)

Sign In for Pricing
View Details
AMHR2 Rabbit mAb
E60M3302 100 µL

AMHR2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2), partial
MBS7100778 Inquire

Recombinant Pseudomonas aeruginosa NADH-quinone oxidoreductase subunit A 2 (nuoA2), partial

Sign In for Pricing
View Details
HEETWATER355X37CARD-T1-P16 Pipe Markers for Water
N005932 3 Card (3 Marker (s) x 1 Card)

HEETWATER355X37CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
RT1-A3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6077705 3x 1.0 µg

RT1-A3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details