Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLURP1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Secreted LY6/PLAUR domain containing 1

Gene Aliases

Anti-neoplastic urinary protein; ANUP; ARS; ARS component B; ARS (component B) -81/S; ArsB; LY6LS; LY6-MT; lymphocyte antigen 6-like secreted; MDM; secreted Ly6/uPAR related protein 1; secreted Ly-6/uPAR-related protein 1; SLURP-1.

Gene ID

57152

Accession Number

NP_065160.1

Reactivity

Homo sapiens|Human

Target

Has an antitumor activity (PubMed:8742060) . Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin (PubMed:14721776, PubMed:17008884) . In vitro down-regulates keratinocyte proliferation; the function may involve the proposed role as modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-7-dependent nAChR currents in an allosteric manner (PubMed:14506129, PubMed:26905431) . In T cells may be involved in regulation of intracellular Ca (2+) signaling (PubMed:17286989) . Seems to have a immunomodulatory function in the cornea (By similarity) . The function may implicate a possible role as a scavenger receptor for PLAU thereby blocking PLAU-dependent functions of PLAUR such as in cell migration and proliferation (PubMed:25168896) .

Type

Protein

Source

E.coli

Sequence

LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for exact concentration.

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SLURP1

Host or Source

Human

Protein Name

Secreted Ly-6/uPAR-related protein 1

Gene Name URL

SLURP1

Nucleotide Accession Number

NM_020427.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostate Specific Antigen (PSA) (KLK3/2871R), 0.2mg/mL
BNUB2871-500 1x 500 µL

Prostate Specific Antigen (PSA) (KLK3/2871R), 0.2mg/mL

Sign In for Pricing
View Details
PRIM1 Antibody
8C15435-AAT 50 µg

PRIM1 Antibody

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812T3-01 20 Tests

Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812T3-02 100 Tests

Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812T3-03 2x 100 Tests

Elab Fluor® Violet 540 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Mouse/Rat PDGF-BB Recombinant Rabbit monoclonal Antibody
HA723812 100 µL

Mouse/Rat PDGF-BB Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details