Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cor a 1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Cor a I.

Reactivity

Corylus avellana

Type

Protein

Source

E.coli

Sequence

GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.4 kDa

Protein Length

Recombinant

Host or Source

Corylus avellana

Protein Name

Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL4 [DBD] (RK5C1) Alexa Fluor® 647
sc-510 AF647 200 µg/mL

GAL4 [DBD] (RK5C1) Alexa Fluor® 647

Sign In for Pricing
View Details
SHOC2 (NM_007373) Human Over-expression Lysate
LS008036 100 µg

SHOC2 (NM_007373) Human Over-expression Lysate

Sign In for Pricing
View Details
Chlamydia trachomatis LPS (MaxLight 405) discontinued
C4250-12F-ML405 100 µL

Chlamydia trachomatis LPS (MaxLight 405) discontinued

Sign In for Pricing
View Details
L-Methionine methyl ester hydrochloride
FM47566-01 100 g

L-Methionine methyl ester hydrochloride

Sign In for Pricing
View Details
L-Methionine methyl ester hydrochloride
FM47566-02 250 g

L-Methionine methyl ester hydrochloride

Sign In for Pricing
View Details
L-Methionine methyl ester hydrochloride
FM47566-03 500 g

L-Methionine methyl ester hydrochloride

Sign In for Pricing
View Details