Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AlbA Recombinant Protein

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA-binding protein Alba

Gene Aliases

DNA-binding protein Alba; PF_RS09500; PF1881.

Gene ID

1469760

Accession Number

WP_011013020.1

Reactivity

Pyrococcus furiosus

Target

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Type

Protein

Source

E.coli

Sequence

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

26.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AlbA

Host or Source

Pyrococcus furiosus

Protein Name

DNA/RNA-binding protein Alba

Gene Name URL

AlbA

Nucleotide Accession Number

NC_003413.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CEND1 shRNA Plasmid
abx975019-01 150 µg

Mouse CEND1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CEND1 shRNA Plasmid
abx975019-02 300 µg

Mouse CEND1 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Human Retinol-binding protein 1, GST, E.coli-500ug
QP6589-ec-500ug 500ug

Recombinant Human Retinol-binding protein 1, GST, E.coli-500ug

Sign In for Pricing
View Details
Synapsin I, phosphorylated (Ser603) discontinued
S9104-04C 100 µL

Synapsin I, phosphorylated (Ser603) discontinued

Sign In for Pricing
View Details
INSYN1 (NM_001039614) Human 3' UTR Clone
SC201234 10 µg

INSYN1 (NM_001039614) Human 3' UTR Clone

Sign In for Pricing
View Details
TRIM39 Protein Vector (Mouse) (pPB-C-His)
PV241546 500 ng

TRIM39 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details