Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AlbA Recombinant Protein

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA-binding protein Alba

Gene Aliases

DNA-binding protein Alba; PF_RS09500; PF1881.

Gene ID

1469760

Accession Number

WP_011013020.1

Reactivity

Pyrococcus furiosus

Target

Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes.

Type

Protein

Source

E.coli

Sequence

MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

26.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AlbA

Host or Source

Pyrococcus furiosus

Protein Name

DNA/RNA-binding protein Alba

Gene Name URL

AlbA

Nucleotide Accession Number

NC_003413.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chinese Hamster BMP-7 ELISA Kit
orb546504 96 Tests

Chinese Hamster BMP-7 ELISA Kit

Sign In for Pricing
View Details
ACTB Antibody - N-terminal region (ARP74366_P050)
ARP74366_P050 100 µL

ACTB Antibody - N-terminal region (ARP74366_P050)

Sign In for Pricing
View Details
Rabbit Polyclonal AlphaB Crystallin/CRYAB [p Ser45] Antibody [Alexa Fluor 647]
NB120-5598AF647 0.1 mL

Rabbit Polyclonal AlphaB Crystallin/CRYAB [p Ser45] Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Human MUC5B (Mucin 5 Subtype B) ELISA Kit
ELK2122-01 48 Tests

Human MUC5B (Mucin 5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Human MUC5B (Mucin 5 Subtype B) ELISA Kit
ELK2122-02 96 Tests

Human MUC5B (Mucin 5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Human MUC5B (Mucin 5 Subtype B) ELISA Kit
ELK2122-03 5x 96 Tests

Human MUC5B (Mucin 5 Subtype B) ELISA Kit

Sign In for Pricing
View Details