Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phl p 5b Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Phl p Vb.

Reactivity

Phleum pratense

Target

Has ribonuclease activity. May be involved in host-pathogen interactions.

Type

Protein

Source

E.coli

Sequence

ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.1 kDa

Protein Length

Recombinant

Host or Source

Phleum pratense

Protein Name

Pollen allergen Phl p 5b

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HFPO oligomer acid fluorides (mixture)
sc-263387 5 g

HFPO oligomer acid fluorides (mixture)

Sign In for Pricing
View Details
UQCRC2 Rabbit Monoclonal Antibody
AMRe21564-01 50 µL

UQCRC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
UQCRC2 Rabbit Monoclonal Antibody
AMRe21564-02 100 µL

UQCRC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
UQCRC2 Rabbit Monoclonal Antibody
AMRe21564-03 200 µL

UQCRC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Glutathione Peroxidase 4 Mouse mAb
GB124327-50 50 μL

Anti-Glutathione Peroxidase 4 Mouse mAb

Sign In for Pricing
View Details
STIM2, NT (STIM2, KIAA1482, Stromal interaction molecule 2) (APC)
MBS6351962-01 0.2 mL

STIM2, NT (STIM2, KIAA1482, Stromal interaction molecule 2) (APC)

Sign In for Pricing
View Details