Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CsrA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Carbon storage regulator.

Gene ID

5551697

Accession Number

WP_000906486.1

Reactivity

Escherichia coli

Target

A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA (s) .

Type

Protein

Source

E.coli

Sequence

MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CSRA

Host or Source

Escherichia coli

Protein Name

Translational regulator CsrA

Gene Name URL

CSRA

Nucleotide Accession Number

NC_010473.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERp19 (TXNDC12) Rabbit Monoclonal Antibody
TA424345 100 µL

ERp19 (TXNDC12) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
UGT2B15 Rabbit Polyclonal Antibody
TA367833 100 µL

UGT2B15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PON3 Antibody
KC-29138-01 50 μL

PON3 Antibody

Sign In for Pricing
View Details
PON3 Antibody
KC-29138-02 100 µL

PON3 Antibody

Sign In for Pricing
View Details
PON3 Antibody
KC-29138-03 1 mL

PON3 Antibody

Sign In for Pricing
View Details
Cathepsin D (Tumor Marker) (CTSD/3275), CF405S conjugate, 0.1mg/mL
BNC043275-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/3275), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details