Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZapA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Z ring-associated protein ZapA.

Reactivity

Bacillus pumilus

Target

Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division.

Type

Protein

Source

E.coli

Sequence

MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ZAPA

Host or Source

Bacillus pumilus

Protein Name

Cell division protein ZapA

Gene Name URL

ZAPA

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFNA21 Recombinant Protein (Human)
RP054654 100 µg

DFNA21 Recombinant Protein (Human)

Sign In for Pricing
View Details
VN2R21P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV789860 1.0 µg DNA

VN2R21P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Bovine Dehydroepiandrosterone sulfate (DHEA-S) ELISA Kit
NSL0167Bo 96 Tests

Bovine Dehydroepiandrosterone sulfate (DHEA-S) ELISA Kit

Sign In for Pricing
View Details
NDUS4 Polyclonal Antibody
ABP59435-01 30 µL

NDUS4 Polyclonal Antibody

Sign In for Pricing
View Details
NDUS4 Polyclonal Antibody
ABP59435-02 100 µL

NDUS4 Polyclonal Antibody

Sign In for Pricing
View Details
NDUS4 Polyclonal Antibody
ABP59435-03 200 µL

NDUS4 Polyclonal Antibody

Sign In for Pricing
View Details