Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNRF3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Zinc and ring finger 3

Gene Aliases

BK747E2.3; CTA-292E10.6; E3 ubiquitin-protein ligase ZNRF3; novel C3HC4 type Zinc finger (ring finger) ; RING finger protein 203; RING-type E3 ubiquitin transferase ZNRF3; RNF203; zinc/RING finger protein 3.

Gene ID

84133

Accession Number

NP_001193927.1

Reactivity

Homo sapiens|Human

Target

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone.

Type

Protein

Source

E.coli

Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ZNRF3

Host or Source

Human

Protein Name

E3 ubiquitin-protein ligase ZNRF3

Gene Name URL

ZNRF3

Nucleotide Accession Number

NM_001206998.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRMS1 antibody
70R-50919 100 ul

BRMS1 antibody

Sign In for Pricing
View Details
C1orf124 (SPRTN) (AK027317) Human Untagged Clone
SC312406 10 µg

C1orf124 (SPRTN) (AK027317) Human Untagged Clone

Sign In for Pricing
View Details
SPAPB15E9.06 Antibody
orb856932 2 mg

SPAPB15E9.06 Antibody

Sign In for Pricing
View Details
Ly6g5b Mouse shRNA Lentiviral Particle (Locus ID 266614)
TL515575V 500 µL Each

Ly6g5b Mouse shRNA Lentiviral Particle (Locus ID 266614)

Sign In for Pricing
View Details
Spermidine solution
RARP068-01 1 mL

Spermidine solution

Sign In for Pricing
View Details
Spermidine solution
RARP068-02 5x 1 mL

Spermidine solution

Sign In for Pricing
View Details