Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PyrE Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

OPRT OPRTase

Accession Number

WP_012698653.1

Reactivity

Laribacter hongkongensis

Target

Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP) .

Type

Protein

Source

E.coli

Sequence

MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PYRE

Host or Source

Laribacter hongkongensis

Protein Name

Orotate phosphoribosyltransferase

Gene Name URL

PYRE

Nucleotide Accession Number

NC_012559.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA12A Human Over-expression Lysate
orb1351065 100 µg

HSPA12A Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human NXF3 shRNA (UAS) - Lentiviral human NXF3 shRNA (UAS, GFP) (100)
GTR15134121 1 Vial

Lentiviral human NXF3 shRNA (UAS) - Lentiviral human NXF3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rat Growth Differentiation Factor 9 ELISA kit
GTR10462046 96 Well

Rat Growth Differentiation Factor 9 ELISA kit

Sign In for Pricing
View Details
XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818)
MBS6009722-01 0.1 mg

XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818)

Sign In for Pricing
View Details
XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818)
MBS6009722-02 5x 0.1 mg

XRCC6BP1 (Mitochondrial Inner Membrane Protease ATP23 Homolog, Ku70-binding Protein 3, XRCC6-binding Protein 1, KUB3, MGC134817, MGC134818)

Sign In for Pricing
View Details
Mouse Macrophage-Derived Chemokine, MDC ELISA Kit
NB-E20197 96 Well

Mouse Macrophage-Derived Chemokine, MDC ELISA Kit

Sign In for Pricing
View Details