Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RplL Recombinant Protein

Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.

Product Specifications

CAS Number

9000-83-3

Gene Aliases

RplL, SAV0540, 50S ribosomal protein L7/L12

Accession Number

WP_001273586.1

Reactivity

Staphylococcus aureus

Target

Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation.

Type

Protein

Source

E.coli

Sequence

MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

28.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RPLL

Host or Source

Staphylococcus aureus

Protein Name

50S ribosomal protein L7/L12

Gene Name URL

RPLL

Nucleotide Accession Number

NC_002758.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), Biotin conjugate, 0.1mg/mL
BNCB0520-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KRTAP1-5 (Keratin-Associated Protein 1-5)
484547 100 µL

KRTAP1-5 (Keratin-Associated Protein 1-5)

Sign In for Pricing
View Details
Usp29 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6362303 1.0 µg DNA

Usp29 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Gpr45 ORF Vector (Rat) (pORF)
ORF067813 1.0 µg DNA

Gpr45 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 550)
MBS6309922-01 0.1 mL

IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 550)

Sign In for Pricing
View Details
IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 550)
MBS6309922-02 5x 0.1 mL

IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 550)

Sign In for Pricing
View Details