Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ostn Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Osteocrin

Gene Aliases

Musclin; osteocrin.

Gene ID

360730

Accession Number

NP_997495.1

Reactivity

Rat|Rattus norvegicus

Target

Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production. Required to enhance physical endurance: induced following physical exercise in muscle and promotes cGMP production, probably by interacting with NPR3/NPR-C. May act as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.

Type

Protein

Source

E.coli

Sequence

SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ostn

Host or Source

Rat

Protein Name

Osteocrin

Gene Name URL

Ostn

Nucleotide Accession Number

NM_207612.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPRY1 Protein Vector (Human) (pPB-C-His)
PV036465 500 ng

RSPRY1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
RHOXF1, ID (RHOXF1, OTEX, PEPP1, Rhox homeobox family member 1, Ovary-, testis- and epididymis-expressed gene protein, Paired-like homeobox protein PEPP-1) (FITC) discontinued
041039-FITC 200 µL

RHOXF1, ID (RHOXF1, OTEX, PEPP1, Rhox homeobox family member 1, Ovary-, testis- and epididymis-expressed gene protein, Paired-like homeobox protein PEPP-1) (FITC) discontinued

Sign In for Pricing
View Details
UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)
TMPH-00113-01 5 µg

UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)

Sign In for Pricing
View Details
UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)
TMPH-00113-02 10 µg

UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)

Sign In for Pricing
View Details
UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)
TMPH-00113-03 20 µg

UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)

Sign In for Pricing
View Details
UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)
TMPH-00113-04 50 µg

UGT78D1 Protein, Arabidopsis thaliana, Recombinant (His)

Sign In for Pricing
View Details