Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPX4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Glutathione peroxidase 4.

Reactivity

Pongo pygmaeus

Target

Essential antioxidant peroxidase that directly reduces phospholipid hydroperoxide even if they are incorporated in membranes and lipoproteins (By similarity) . Can also reduce fatty acid hydroperoxide, cholesterol hydroperoxide and thymine hydroperoxide (By similarity) . Plays a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation. Required to prevent cells from ferroptosis, a non-apoptotic cell death resulting from an iron-dependent accumulation of lipid reactive oxygen species. The presence of selenocysteine (Sec) versus Cys at the active site is essential for life: it provides resistance to overoxidation and prevents cells against ferroptosis. The presence of Sec at the active site is also essential for the survival of a specific type of parvalbumin-positive interneurons, thereby preventing against fatal epileptic seizures. May be required to protect cells from the toxicity of ingested lipid hydroperoxides. Required for normal sperm development and male fertility. Essential for maturation and survival of photoreceptor cells. Plays a role in a primary T-cell response to viral and parasitic infection by protecting T-cells from ferroptosis and by supporting T-cell expansion (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GPX4

Host or Source

Ongo pygmaeus

Protein Name

Phospholipid hydroperoxide glutathione peroxidase

Gene Name URL

GPX4

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tdg activation kit by CRISPRa
GA204276 1 Kit

Mouse Tdg activation kit by CRISPRa

Sign In for Pricing
View Details
2,6-Dichloro-4-nitroaniline
GK0378-25g 25 g

2,6-Dichloro-4-nitroaniline

Sign In for Pricing
View Details
ELISA Kit For Cholinesterase
E8904h 96 Tests

ELISA Kit For Cholinesterase

Sign In for Pricing
View Details
DERA CRISPR/Cas9 KO Plasmid (m)
sc-433176 20 µg

DERA CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Entpd7 sgRNA CRISPR Lentivector set (Mouse)
K3521901 3x 1.0 µg

Entpd7 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
N4-Triazolyl Terconazole
460377-01 1 mg

N4-Triazolyl Terconazole

Sign In for Pricing
View Details