What is the catalog number for PtsH Recombinant Protein?

The catalog number for PtsH Recombinant Protein is OPCA03382-1MG.

What sizes are available for PtsH Recombinant Protein?

PtsH Recombinant Protein is available in the following size(s): 1 mg.

Is PtsH Recombinant Protein in stock?

PtsH Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

PtsH Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) |phosphocarrier protein HPr

Gene Aliases

BAMF_1467; BAMF_RS27980; BSU_13900; BSU13900; histidine-containing phosphocarrier protein of the phosphotransferase system (PTS) (HPr protein) ; Histidine-containing protein; phosphocarrier protein HPr.

Gene ID

939259|9779573

Accession Number

NP_389273.1

Reactivity

Bacillus amyloliquefaciens|Bacillus subtilis

Target

General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS) . This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the PTS EIIA domain.

Type

Protein

Source

E.coli

Sequence

AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEETMKSEGLGE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BAMF_RS27980|ptsH

Host or Source

Bacillus subtilis

Protein Name

Phosphocarrier protein HPr

Gene Name URL

BAMF_RS27980|ptsH

Nucleotide Accession Number

NC_000964.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF568 conjugate, 0.1mg/mL

BNC681045-100 1x 100 µL