Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tachylectin-2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Lectin L10c.

Reactivity

Tachypleus tridentatus

Target

Lectin that binds specifically to N-acetylglucosamine and N-acetylgalactosamine. Is part of the innate immunity host defense system of the horseshoe crab.

Type

Protein

Source

E.coli

Sequence

VGGESMLRGVYQDKFYQGTYPQNKNDNWLARATLIGKGGWSNFKFLFLSPGGELYGVLNDKIYKGTPPTHDNDNWMGRAKKIGNGGWNQFQFLFFDPNGYLYAVSKDKLYKASPPQSDTDNWIARATEIGSGGWSGFKFLFFHPNGYLYAVHGQQFYKALPPVSNQDNWLARATKIGQGGWDTFKFLFFSSVGTLFGVQGGKFYEDYPPSYAHDNWLARAKLIGNGGWDDFRFLFF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.8 kDa

Protein Length

Recombinant

Host or Source

Tachypleus tridentatus

Protein Name

Tachylectin-2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SB 242084
B5348-10 10 mg

SB 242084

Sign In for Pricing
View Details
pExpress-1-Arhgap24 Plasmid
PVT53828 2 µg

pExpress-1-Arhgap24 Plasmid

Sign In for Pricing
View Details
alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: OTI4G9]
TA809082S 30 µL

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: OTI4G9]

Sign In for Pricing
View Details
UCRC (Ubiquinol-cytochrome c Reductase Complex 7.2kD Protein, UQCR10, Cytochrome b-c1 Complex Subunit 9, Complex III Subunit 9, Complex III Subunit X, Cytochrome c1 Non-heme 7kD Protein, HSPC119) (PE)
MBS6160964-01 0.1 mL

UCRC (Ubiquinol-cytochrome c Reductase Complex 7.2kD Protein, UQCR10, Cytochrome b-c1 Complex Subunit 9, Complex III Subunit 9, Complex III Subunit X, Cytochrome c1 Non-heme 7kD Protein, HSPC119) (PE)

Sign In for Pricing
View Details
UCRC (Ubiquinol-cytochrome c Reductase Complex 7.2kD Protein, UQCR10, Cytochrome b-c1 Complex Subunit 9, Complex III Subunit 9, Complex III Subunit X, Cytochrome c1 Non-heme 7kD Protein, HSPC119) (PE)
MBS6160964-02 5x 0.1 mL

UCRC (Ubiquinol-cytochrome c Reductase Complex 7.2kD Protein, UQCR10, Cytochrome b-c1 Complex Subunit 9, Complex III Subunit 9, Complex III Subunit X, Cytochrome c1 Non-heme 7kD Protein, HSPC119) (PE)

Sign In for Pricing
View Details
Ubiquitin Carboxyl-Terminal Hydrolase 9X (USP9X) Antibody (HRP)
abx337186-01 20 µg

Ubiquitin Carboxyl-Terminal Hydrolase 9X (USP9X) Antibody (HRP)

Sign In for Pricing
View Details