Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AaH2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

AaH II; Neurotoxin 2.

Reactivity

Androctonus australis

Target

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels (PubMed:23685008) . It is active on rat brain Nav1.2/SCN2A sodium channel (EC (50) =2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC (50) =2.2 nM) (PubMed:12911331), as well as on human neuronal Nav1.7/SCN9A (EC (50) =6.8 nM) (PubMed:23685008) . This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses (PubMed:23685008) .

Type

Protein

Source

E.coli

Sequence

VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.3 kDa

Protein Length

Recombinant

Host or Source

Androctonus australis

Protein Name

Alpha-mammal toxin AaH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ant-m7GDP
NU-228L 5x 100 µL

Ant-m7GDP

Sign In for Pricing
View Details
SLC26A8 antibody - C-terminal region (ARP44085_T100)
ARP44085_T100 100 µL

SLC26A8 antibody - C-terminal region (ARP44085_T100)

Sign In for Pricing
View Details
RPS26P45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
42333111 3x 1.0 µg

RPS26P45 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human DTX1 Knockout A549 cell line
GTR15411248 1 Vial

Human DTX1 Knockout A549 cell line

Sign In for Pricing
View Details
DKK1 (Dickkopf Homolog 1 (Xenopus laevis), DKK-1, SK) (MaxLight 405) discontinued
245362-ML405 100 µL

DKK1 (Dickkopf Homolog 1 (Xenopus laevis), DKK-1, SK) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Flavopiridol
WGC308118-5mg 5 mg

Flavopiridol

Sign In for Pricing
View Details