Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNG Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

IFN-gamma

Reactivity

Marmota monax|Woodchuck

Target

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Type

Protein

Source

E.coli

Sequence

QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IFNG

Host or Source

Marmota monax

Protein Name

Interferon gamma

Gene Name URL

IFNG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-17A Monoclonal Antibody (Clone: ABM2A18)
10-4010-100 100 µg

Anti-IL-17A Monoclonal Antibody (Clone: ABM2A18)

Sign In for Pricing
View Details
Actin Related Protein 2 Rabbit Monoclonal Antibody
E56G2708 100 µL

Actin Related Protein 2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
VGLUT2 Antibody
MBS804171-01 0.1 mg

VGLUT2 Antibody

Sign In for Pricing
View Details
VGLUT2 Antibody
MBS804171-02 5x 0.1 mg

VGLUT2 Antibody

Sign In for Pricing
View Details
GCC1 Rabbit Polyclonal Antibody (BF488)
orb2525799 100 µL

GCC1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Anti-ROM1 Antibody Picoband® Fluoro594 Conjugated
A07035-1-Fluoro594 100 µg/Vial

Anti-ROM1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details