Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ugl Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Glycosaminoglycan hydrolase; Glycuronidase; Unsaturated uronic acid hydrolase.

Reactivity

Bacillus

Target

Catalyzes the hydrolysis of oligosaccharides with unsaturated glucuronyl residues at the non-reducing terminal, to a sugar or an amino sugar, and an unsaturated D-glucuronic acid (GlcA), which is nonenzymatically converted immediately to alpha-keto acid.

Type

Protein

Source

E.coli

Sequence

MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UGL

Host or Source

Bacillus sp.

Protein Name

Unsaturated glucuronyl hydrolase

Gene Name URL

UGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken anti Endomysial antibody (EMA) (IgA) ELISA Kit
GTR10335927 96 Well

Chicken anti Endomysial antibody (EMA) (IgA) ELISA Kit

Sign In for Pricing
View Details
RGD1306750 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV647601 1.0 µg DNA

RGD1306750 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
OTUD4 CRISPR Knock Out 293T Cell Line (Human)
35821141 1x 10^6 Cells / 1.0 mL

OTUD4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SLC20A1 Protein Vector (Rat) (pPB-N-His)
PV305435 500 ng

SLC20A1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Cpsf3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
16780116 3x 1.0 µg

Cpsf3l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse CD37, clone IPO-24 (Monoclonal) Antibody
orb301807 100 µg

Mouse CD37, clone IPO-24 (Monoclonal) Antibody

Sign In for Pricing
View Details