HSP70 Recombinant Protein
Product Specifications
CAS Number
9000-83-3
Gene Aliases
Allergen: Alt a 3
Reactivity
Alternaria alternata
Type
Protein
Source
E.coli
Sequence
KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
20.2 kDa
Protein Length
Recombinant
NCBI Gene Symbol
HSP70
Host or Source
Alternaria alternata
Protein Name
Heat shock 70 kDa protein
Gene Name URL
HSP70
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2101352-01 5x 96 Tests
Porcine Noggin (NOG) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101352-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Porcine Noggin (NOG) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101352-03 10x 96 Tests
Porcine Noggin (NOG) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101352-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Porcine Noggin (NOG) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details 
bsm-62500R-Cy7-01 20 µL
CPSF73 Recombinant Antibody, Cy7 Conjugated
Sign In for Pricing
View Details bsm-62500R-Cy7-02 100 µL
CPSF73 Recombinant Antibody, Cy7 Conjugated
Sign In for Pricing
View Details