Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP70 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: Alt a 3

Reactivity

Alternaria alternata

Type

Protein

Source

E.coli

Sequence

KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HSP70

Host or Source

Alternaria alternata

Protein Name

Heat shock 70 kDa protein

Gene Name URL

HSP70

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant eIF3B Antibody
RC-4996-01 50 μL

Recombinant eIF3B Antibody

Sign In for Pricing
View Details
Recombinant eIF3B Antibody
RC-4996-02 100 µL

Recombinant eIF3B Antibody

Sign In for Pricing
View Details
Recombinant eIF3B Antibody
RC-4996-03 1 mL

Recombinant eIF3B Antibody

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), 1mg/mL
BNUM2838-50 1x 50 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), 1mg/mL

Sign In for Pricing
View Details
Guvacoline Hydrochloride
TRC-G876510-50MG 50 mg

Guvacoline Hydrochloride

Sign In for Pricing
View Details
SIL1 (Center) Rabbit Polyclonal Antibody
AP17745PU-N 400 µL

SIL1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details