Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP70 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: Alt a 3

Reactivity

Alternaria alternata

Type

Protein

Source

E.coli

Sequence

KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HSP70

Host or Source

Alternaria alternata

Protein Name

Heat shock 70 kDa protein

Gene Name URL

HSP70

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbx1-set siRNA/shRNA/RNAi Lentivector (Mouse)
46298094 4x 500 ng

Tbx1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Manumycin A
GL8712-5mg 5 mg

Manumycin A

Sign In for Pricing
View Details
G2A (GPR132) Human shRNA Plasmid Kit (Locus ID 29933)
TR312669 1 Kit

G2A (GPR132) Human shRNA Plasmid Kit (Locus ID 29933)

Sign In for Pricing
View Details
C9orf59 Polyclonal Antibody, PerCP Conjugated
bs-9656R-PerCP 100 µL

C9orf59 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
TWIK-2 CRISPR/Cas9 KO Plasmid (h)
sc-407263 20 µg

TWIK-2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
RARRES3 (PLAAT4) (NM_004585) Human Tagged Lenti ORF Clone
RC201923L2 10 µg

RARRES3 (PLAAT4) (NM_004585) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details