Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBla g 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Bla g IV.

Reactivity

Blattella germanica

Target

Probable ligand-binding protein.

Type

Protein

Source

E.coli

Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.8 kDa

Protein Length

Recombinant

Host or Source

Blattella germanica

Protein Name

Allergen Bla g 4

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMZ-171-Binocular P Stero Microscope
MIC5446 1 Each

SMZ-171-Binocular P Stero Microscope

Sign In for Pricing
View Details
Tcn2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3856105 3x 1.0 µg

Tcn2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TMEM126B (Transmembrane Protein 126B, HT007) (PE)
MBS6396653-01 0.1 mL

TMEM126B (Transmembrane Protein 126B, HT007) (PE)

Sign In for Pricing
View Details
TMEM126B (Transmembrane Protein 126B, HT007) (PE)
MBS6396653-02 5x 0.1 mL

TMEM126B (Transmembrane Protein 126B, HT007) (PE)

Sign In for Pricing
View Details
CUTC (NM_015960) Human 3' UTR Clone
SC205471 10 µg

CUTC (NM_015960) Human 3' UTR Clone

Sign In for Pricing
View Details
MAGED4 (NM_001272061) Human Tagged ORF Clone
RC234844 10 µg

MAGED4 (NM_001272061) Human Tagged ORF Clone

Sign In for Pricing
View Details