Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBla g 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Bla g IV.

Reactivity

Blattella germanica

Target

Probable ligand-binding protein.

Type

Protein

Source

E.coli

Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.8 kDa

Protein Length

Recombinant

Host or Source

Blattella germanica

Protein Name

Allergen Bla g 4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADIPOQ Antibody
CSB-PA293186-01 50 μL

ADIPOQ Antibody

Sign In for Pricing
View Details
ADIPOQ Antibody
CSB-PA293186-02 100 µL

ADIPOQ Antibody

Sign In for Pricing
View Details
UBE2E3 Rabbit Polyclonal Antibody (PE-Cy5)
orb1036967 100 µL

UBE2E3 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Bcl10 (NM_009740) Mouse Tagged ORF Clone Lentiviral Particle
MR202822L3V 200 µL

Bcl10 (NM_009740) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-bovine NGF IgG fraction (polyclonal)
PA-023-9 1 mg

Rabbit anti-bovine NGF IgG fraction (polyclonal)

Sign In for Pricing
View Details
Anti-CD69 Antibody-FITC labled
MBS8321506-01 25 Assays

Anti-CD69 Antibody-FITC labled

Sign In for Pricing
View Details