Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LqhaIT Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Lqh-alpha-IT.

Reactivity

Leiurus quinquestriatus

Target

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Type

Protein

Source

E.coli

Sequence

VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.5 kDa

Protein Length

Recombinant

Host or Source

Leiurus quinquestriatus hebraeus

Protein Name

Alpha-insect toxin LqhaIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD8 alpha Ready-To-Use IHC Kit
orb3001424 50 Tests

Mouse CD8 alpha Ready-To-Use IHC Kit

Sign In for Pricing
View Details
5-Bromo-2,1,3-benzoxadiazole
sc-262490 1 g

5-Bromo-2,1,3-benzoxadiazole

Sign In for Pricing
View Details
Phenyl 2-azido-2,6-dideoxy-1-seleno-α-D-galactopyranoside
GC8302-250mg 250 mg

Phenyl 2-azido-2,6-dideoxy-1-seleno-α-D-galactopyranoside

Sign In for Pricing
View Details
Anti-RNF25 Rabbit pAb
GB111422-50 50 μL

Anti-RNF25 Rabbit pAb

Sign In for Pricing
View Details
Human Filamin C gamma (FLNC) CLIA Kit
abx196661-01 96 Tests

Human Filamin C gamma (FLNC) CLIA Kit

Sign In for Pricing
View Details
Human Filamin C gamma (FLNC) CLIA Kit
abx196661-02 5x 96 Tests

Human Filamin C gamma (FLNC) CLIA Kit

Sign In for Pricing
View Details